Lineage for d2blea_ (2ble A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080793Species Human (Homo sapiens) [TaxId:9606] [230557] (5 PDB entries)
  8. 2080802Domain d2blea_: 2ble A: [303593]
    automated match to d4zqma_
    complexed with 5gp, na

Details for d2blea_

PDB Entry: 2ble (more details), 1.9 Å

PDB Description: structure of human guanosine monophosphate reductase gmpr1 in complex with gmp
PDB Compounds: (A:) gmp reductase I

SCOPe Domain Sequences for d2blea_:

Sequence, based on SEQRES records: (download)

>d2blea_ c.1.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpridadlkldfkdvllrpkrsslksraevdlertftfrnskqtysgipiivanmdtvgt
femaavmsqhsmftaihkhyslddwklfatnhpeclqnvavssgsgqndlekmtsileav
pqvkficldvangysehfvefvklvrakfpehtimagnvvtgemveelilsgadiikvgv
gpgsvcttrtktgvgypqlsaviecadsahglkghiisdggctcpgdvakafgagadfvm
lggmfsghtecagevierngrklklfygmssdtamnkhaggvaeyrasegktvevpykgd
ventildilgglrstctyvgaaklkelsrratfirvtqqhntv

Sequence, based on observed residues (ATOM records): (download)

>d2blea_ c.1.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpridadlkldfkdvllrpkrsslksraevdlertftfrnskqtysgipiivanmdtvgt
femaavmsqhsmftaihkhyslddwklfatnhpeclqnvavssgsgqndlekmtsileav
pqvkficldvangysehfvefvklvrakfpehtimagnvvtgemveelilsgadiikvgv
gpgsvcttrtktgvgypqlsaviecadsahglkghiisdggctcpgdvakafgagadfvm
lggmfsghtecagevirklklfygmssdtamnkhgvaeyrasegktvevpykgdventil
dilgglrstctyvgaaklkelsrratfirvtqqhntv

SCOPe Domain Coordinates for d2blea_:

Click to download the PDB-style file with coordinates for d2blea_.
(The format of our PDB-style files is described here.)

Timeline for d2blea_:

  • d2blea_ is new in SCOPe 2.06-stable