SCOPe 2.07: Domain d2bk7d2: 2bk7 D:99-217

Lineage for d2bk7d2 (2bk7 D:99-217)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.5: Latexin-like [142991] (2 proteins)
   Pfam PF06907; duplication: consits of two domains of this fold

6. Protein automated matches [230383] (2 species)
   not a true protein

7. Species Homo sapiens [311199] (1 PDB entry)

8. Domain d2bk7d2: 2bk7 D:99-217 [303592]
   Other proteins in same PDB: d2bk7a_, d2bk7b1, d2bk7b2, d2bk7c_
   automated match to d2bo9b2
   complexed with acn, mpd, nag, val, zn

Details for d2bk7d2

PDB Entry: 2bk7, 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.

PDB Compounds: (D:) human latexin

SCOPe Domain Sequences for d2bk7d2:

Sequence; same for both SEQRES and ATOM records:

>d2bk7d2 d.17.1.5 (D:99-217) automated matches {Homo sapiens}
pdeedntfyqrlksmkepleaqnipdnfgnvspemtlvlhlawvacgyiiwqnstedtwy
kmvkiqtvkqvqrnddfieldytillhniasqeiipwqmqvlwhpqvgtkvkhnsrlpk

Timeline for d2bk7d2:

• d2bk7d2 first appeared in SCOPe 2.06
  
• d2bk7d2 appears in the current release, SCOPe 2.08