Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.5: Latexin-like [142991] (2 proteins) Pfam PF06907; duplication: consits of two domains of this fold |
Protein automated matches [230383] (2 species) not a true protein |
Species Homo sapiens [311199] (1 PDB entry) |
Domain d2bk7d1: 2bk7 D:1-98 [303591] Other proteins in same PDB: d2bk7a_, d2bk7b1, d2bk7b2, d2bk7c_ automated match to d2bo9b1 complexed with acn, mpd, nag, val, zn |
PDB Entry: 2bk7 (more details), 1.6 Å
SCOPe Domain Sequences for d2bk7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bk7d1 d.17.1.5 (D:1-98) automated matches {Homo sapiens} meipptnypasraalvaqnyinyqqgtphrvfevqkvkqasmedipgrghkyrlkfavee iiqkqvkvnctaevlypstgqetapevnftfegetgkn
Timeline for d2bk7d1:
View in 3D Domains from other chains: (mouse over for more information) d2bk7a_, d2bk7b1, d2bk7b2, d2bk7c_ |