Lineage for d2bk7c_ (2bk7 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497308Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2497309Protein Carboxypeptidase A [53189] (4 species)
  7. 2497363Species Human (Homo sapiens) [TaxId:9606] [53192] (6 PDB entries)
  8. 2497365Domain d2bk7c_: 2bk7 C: [303590]
    Other proteins in same PDB: d2bk7b1, d2bk7b2, d2bk7d1, d2bk7d2
    automated match to d2bo9a1
    complexed with acn, mpd, nag, val, zn

Details for d2bk7c_

PDB Entry: 2bk7 (more details), 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.
PDB Compounds: (C:) carboxypeptidase a4

SCOPe Domain Sequences for d2bk7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk7c_ c.56.5.1 (C:) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
ssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpa
vwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqt
qnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvd
fiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvg
ptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktim
ehvrdnl

SCOPe Domain Coordinates for d2bk7c_:

Click to download the PDB-style file with coordinates for d2bk7c_.
(The format of our PDB-style files is described here.)

Timeline for d2bk7c_: