SCOPe 2.07: Domain d2bk7b2: 2bk7 B:99-217

Lineage for d2bk7b2 (2bk7 B:99-217)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.5: Latexin-like [142991] (2 proteins)
   Pfam PF06907; duplication: consits of two domains of this fold

6. Protein Latexin [142992] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142993] (2 PDB entries)
   Uniprot Q9BS40 1-98! Uniprot Q9BS40 99-217

8. Domain d2bk7b2: 2bk7 B:99-217 [303589]
   Other proteins in same PDB: d2bk7a_, d2bk7c_, d2bk7d1, d2bk7d2
   automated match to d2bo9b2
   complexed with acn, mpd, nag, val, zn

Details for d2bk7b2

PDB Entry: 2bk7, 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.

PDB Compounds: (B:) human latexin

SCOPe Domain Sequences for d2bk7b2:

Sequence; same for both SEQRES and ATOM records:

>d2bk7b2 d.17.1.5 (B:99-217) Latexin {Human (Homo sapiens) [TaxId: 9606]}
pdeedntfyqrlksmkepleaqnipdnfgnvspemtlvlhlawvacgyiiwqnstedtwy
kmvkiqtvkqvqrnddfieldytillhniasqeiipwqmqvlwhpqygtkvkhnsrlpk

Timeline for d2bk7b2:

• d2bk7b2 first appeared in SCOPe 2.06
  
• d2bk7b2 appears in the current release, SCOPe 2.08