Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.5: Latexin-like [142991] (2 proteins) Pfam PF06907; duplication: consits of two domains of this fold |
Protein Latexin [142992] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142993] (2 PDB entries) Uniprot Q9BS40 1-98! Uniprot Q9BS40 99-217 |
Domain d2bk7b2: 2bk7 B:99-217 [303589] Other proteins in same PDB: d2bk7a_, d2bk7c_, d2bk7d1, d2bk7d2 automated match to d2bo9b2 complexed with acn, mpd, nag, val, zn |
PDB Entry: 2bk7 (more details), 1.6 Å
SCOPe Domain Sequences for d2bk7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bk7b2 d.17.1.5 (B:99-217) Latexin {Human (Homo sapiens) [TaxId: 9606]} pdeedntfyqrlksmkepleaqnipdnfgnvspemtlvlhlawvacgyiiwqnstedtwy kmvkiqtvkqvqrnddfieldytillhniasqeiipwqmqvlwhpqygtkvkhnsrlpk
Timeline for d2bk7b2:
View in 3D Domains from other chains: (mouse over for more information) d2bk7a_, d2bk7c_, d2bk7d1, d2bk7d2 |