Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
Protein Carboxypeptidase A [53189] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [53192] (6 PDB entries) |
Domain d2bk7a_: 2bk7 A: [303587] Other proteins in same PDB: d2bk7b1, d2bk7b2, d2bk7d1, d2bk7d2 automated match to d2bo9a1 complexed with acn, mpd, nag, val, zn |
PDB Entry: 2bk7 (more details), 1.6 Å
SCOPe Domain Sequences for d2bk7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bk7a_ c.56.5.1 (A:) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} ssnnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpa vwlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqt qnrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvd fiqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvg ptcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktim ehvrdnl
Timeline for d2bk7a_: