Lineage for d2bixb_ (2bix B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066532Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2066533Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2066534Protein RPE65 [310786] (2 species)
  7. 2066546Species Synechocystis sp. [TaxId:1143] [311042] (4 PDB entries)
  8. 2066556Domain d2bixb_: 2bix B: [303586]
    automated match to d2biwa_
    complexed with c8e, gol

Details for d2bixb_

PDB Entry: 2bix (more details), 2.68 Å

PDB Description: crystal structure of apocarotenoid cleavage oxygenase from synechocystis, fe-free apoenzyme
PDB Compounds: (B:) apocarotenoid-cleaving oxygenase

SCOPe Domain Sequences for d2bixb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bixb_ b.69.15.1 (B:) RPE65 {Synechocystis sp. [TaxId: 1143]}
qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt

SCOPe Domain Coordinates for d2bixb_:

Click to download the PDB-style file with coordinates for d2bixb_.
(The format of our PDB-style files is described here.)

Timeline for d2bixb_:

  • d2bixb_ is new in SCOPe 2.06-stable