Lineage for d2biwd_ (2biw D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399860Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2399861Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2399862Protein RPE65 [310786] (2 species)
  7. 2399878Species Synechocystis sp. [TaxId:1143] [311042] (5 PDB entries)
  8. 2399886Domain d2biwd_: 2biw D: [303584]
    automated match to d2biwa_
    complexed with 3on, fe

Details for d2biwd_

PDB Entry: 2biw (more details), 2.39 Å

PDB Description: crystal structure of apocarotenoid cleavage oxygenase from synechocystis, native enzyme
PDB Compounds: (D:) apocarotenoid-cleaving oxygenase

SCOPe Domain Sequences for d2biwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2biwd_ b.69.15.1 (D:) RPE65 {Synechocystis sp. [TaxId: 1143]}
qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt

SCOPe Domain Coordinates for d2biwd_:

Click to download the PDB-style file with coordinates for d2biwd_.
(The format of our PDB-style files is described here.)

Timeline for d2biwd_: