| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
| Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries) |
| Domain d1iuxa1: 1iux A:1-173,A:276-394 [30358] Other proteins in same PDB: d1iuxa2 complexed with fad, phb |
PDB Entry: 1iux (more details), 2 Å
SCOPe Domain Sequences for d1iuxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuxa1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie
Timeline for d1iuxa1: