SCOPe 2.06: Domain d2bghb1: 2bgh B:4-210

Lineage for d2bghb1 (2bgh B:4-210)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.4: benzylalcohol acetyl-, anthocyanin-O-hydroxy-cinnamoyl-, anthranilate-N-hydroxy-cinnamoyl/benzoyl-, deacetylvindoline acetyltransferase (BAHD) family [310660] (2 proteins)
   Pfam PF02458

6. Protein Vinorine synthase [310825] (1 species)

7. Species Rauvolfia serpentina [TaxId:4060] [311094] (1 PDB entry)

8. Domain d2bghb1: 2bgh B:4-210 [303577]

Details for d2bghb1

PDB Entry: 2bgh, 2.6 Å

PDB Description: crystal structure of vinorine synthase

PDB Compounds: (B:) vinorine synthase

SCOPe Domain Sequences for d2bghb1:

Sequence; same for both SEQRES and ATOM records:

>d2bghb1 c.43.1.4 (B:4-210) Vinorine synthase {Rauvolfia serpentina [TaxId: 4060]}
qmekvseelilpssptpqslkcykishldqllltchipfilfypnpldsnldpaqtsqhl
kqslskvlthfyplagrinvnssvdcndsgvpfvearvqaqlsqaiqnvvelekldqylp
saaypggkievnedvplavkisffecggtaigvnlshkiadvlslatflnawtatcrget
eivlpnfdlaarhfppvdntpspelvp

Timeline for d2bghb1:

• d2bghb1 is new in SCOPe 2.06-stable
  
• d2bghb1 appears in SCOPe 2.07
  
• d2bghb1 appears in the current release, SCOPe 2.08