Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein N-acylamino acid racemase [110372] (4 species) |
Species Deinococcus radiodurans [TaxId:1299] [110374] (5 PDB entries) Uniprot Q9RYA6 |
Domain d2bahc2: 2bah C:133-375 [303571] Other proteins in same PDB: d2baha1, d2bahb1, d2bahc1, d2bahd1 automated match to d2fkpa1 mutant |
PDB Entry: 2bah (more details), 2 Å
SCOPe Domain Sequences for d2bahc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bahc2 c.1.11.2 (C:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} hkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirl tvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasas darkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihls clsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqee hra
Timeline for d2bahc2: