Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species) |
Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries) |
Domain d1iuwa1: 1iuw A:1-173,A:276-394 [30357] Other proteins in same PDB: d1iuwa2 complexed with fad, phb |
PDB Entry: 1iuw (more details), 2 Å
SCOPe Domain Sequences for d1iuwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuwa1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie
Timeline for d1iuwa1: