SCOPe 2.07: Domain d2b79b2: 2b79 B:1-137

Lineage for d2b79b2 (2b79 B:1-137)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.9: Smu440-like [160747] (1 protein)
   PfamB PB094079

6. Protein Hypothetical protein SMU440 [160748] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [160749] (2 PDB entries)
   Uniprot Q8DVN6 1-137

8. Domain d2b79b2: 2b79 B:1-137 [303553]
   Other proteins in same PDB: d2b79a3, d2b79b3
   automated match to d3ijtb_
   complexed with nh4

Details for d2b79b2

PDB Entry: 2b79, 2.4 Å

PDB Description: Crystal Structure of SMU.440 from Streptococcus mutans

PDB Compounds: (B:) hypothetical protein SMU.440

SCOPe Domain Sequences for d2b79b2:

Sequence; same for both SEQRES and ATOM records:

>d2b79b2 d.129.3.9 (B:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]}
mkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmedmpelaf
tlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteealaflkqi
fadvpesvgklkqilet

Timeline for d2b79b2:

• d2b79b2 first appeared in SCOPe 2.06
  
• d2b79b2 appears in the current release, SCOPe 2.08