Lineage for d2b79b2 (2b79 B:1-137)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215217Family d.129.3.9: Smu440-like [160747] (1 protein)
    PfamB PB094079
  6. 2215218Protein Hypothetical protein SMU440 [160748] (1 species)
  7. 2215219Species Streptococcus mutans [TaxId:1309] [160749] (2 PDB entries)
    Uniprot Q8DVN6 1-137
  8. 2215223Domain d2b79b2: 2b79 B:1-137 [303553]
    Other proteins in same PDB: d2b79a3, d2b79b3
    automated match to d3ijtb_
    complexed with nh4

Details for d2b79b2

PDB Entry: 2b79 (more details), 2.4 Å

PDB Description: Crystal Structure of SMU.440 from Streptococcus mutans
PDB Compounds: (B:) hypothetical protein SMU.440

SCOPe Domain Sequences for d2b79b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b79b2 d.129.3.9 (B:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]}
mkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmedmpelaf
tlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteealaflkqi
fadvpesvgklkqilet

SCOPe Domain Coordinates for d2b79b2:

Click to download the PDB-style file with coordinates for d2b79b2.
(The format of our PDB-style files is described here.)

Timeline for d2b79b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b79b3