![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.9: Smu440-like [160747] (1 protein) PfamB PB094079 |
![]() | Protein Hypothetical protein SMU440 [160748] (1 species) |
![]() | Species Streptococcus mutans [TaxId:1309] [160749] (2 PDB entries) Uniprot Q8DVN6 1-137 |
![]() | Domain d2b79b2: 2b79 B:1-137 [303553] Other proteins in same PDB: d2b79a3, d2b79b3 automated match to d3ijtb_ complexed with nh4 |
PDB Entry: 2b79 (more details), 2.4 Å
SCOPe Domain Sequences for d2b79b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b79b2 d.129.3.9 (B:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} mkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmedmpelaf tlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteealaflkqi fadvpesvgklkqilet
Timeline for d2b79b2: