Lineage for d2b6da_ (2b6d A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145370Family c.94.1.2: Transferrin [53888] (4 protein domains)
    further duplication: composed of two two-domain lobes
  6. 2145371Protein Lactoferrin [53889] (6 species)
  7. 2145377Species Cow (Bos taurus) [TaxId:9913] [53891] (19 PDB entries)
  8. 2145379Domain d2b6da_: 2b6d A: [303550]
    automated match to d4oqoa_
    complexed with co3, dif, eoh, fe, so4, zn

Details for d2b6da_

PDB Entry: 2b6d (more details), 1.4 Å

PDB Description: Specific binding of non-steroidal anti-inflammatory drugs (NSAIDS) to lactoferrin: Crystal structure of the complex of C-terminal lobe of bovine lactoferrin with diclofenac at 1.4 A resolution
PDB Compounds: (A:) lactotransferrin

SCOPe Domain Sequences for d2b6da_:

Sequence, based on SEQRES records: (download)

>d2b6da_ c.94.1.2 (A:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacaf

Sequence, based on observed residues (ATOM records): (download)

>d2b6da_ c.94.1.2 (A:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcsleacaf

SCOPe Domain Coordinates for d2b6da_:

Click to download the PDB-style file with coordinates for d2b6da_.
(The format of our PDB-style files is described here.)

Timeline for d2b6da_:

  • d2b6da_ is new in SCOPe 2.06-stable