Lineage for d2b3nb_ (2b3n B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550843Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 2550891Protein Hypothetical protein AF1124 [143171] (1 species)
  7. 2550892Species Archaeoglobus fulgidus [TaxId:2234] [143172] (3 PDB entries)
    Uniprot O29141 6-159
  8. 2550896Domain d2b3nb_: 2b3n B: [303549]
    automated match to d2b3ma1
    complexed with 144, po4

Details for d2b3nb_

PDB Entry: 2b3n (more details), 1.25 Å

PDB Description: Crystal structure of protein AF1124 from Archaeoglobus fulgidus
PDB Compounds: (B:) hypothetical protein AF1124

SCOPe Domain Sequences for d2b3nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3nb_ d.38.1.4 (B:) Hypothetical protein AF1124 {Archaeoglobus fulgidus [TaxId: 2234]}
vkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnp
vhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrve
gvvsgveknrytidvkcytgdkvvaegvvkvliw

SCOPe Domain Coordinates for d2b3nb_:

Click to download the PDB-style file with coordinates for d2b3nb_.
(The format of our PDB-style files is described here.)

Timeline for d2b3nb_: