| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
| Family d.38.1.4: MaoC-like [82636] (6 proteins) |
| Protein Hypothetical protein AF1124 [143171] (1 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [143172] (3 PDB entries) Uniprot O29141 6-159 |
| Domain d2b3nb_: 2b3n B: [303549] automated match to d2b3ma1 complexed with 144, po4 |
PDB Entry: 2b3n (more details), 1.25 Å
SCOPe Domain Sequences for d2b3nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3nb_ d.38.1.4 (B:) Hypothetical protein AF1124 {Archaeoglobus fulgidus [TaxId: 2234]}
vkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnp
vhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrve
gvvsgveknrytidvkcytgdkvvaegvvkvliw
Timeline for d2b3nb_: