SCOPe 2.08: Domain d2b3na_: 2b3n A:

Lineage for d2b3na_ (2b3n A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein Hypothetical protein AF1124 [143171] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [143172] (3 PDB entries)
   Uniprot O29141 6-159

8. Domain d2b3na_: 2b3n A: [303548]
   automated match to d2b3ma1
   complexed with 144, po4

Details for d2b3na_

PDB Entry: 2b3n, 1.25 Å

PDB Description: Crystal structure of protein AF1124 from Archaeoglobus fulgidus

PDB Compounds: (A:) hypothetical protein AF1124

SCOPe Domain Sequences for d2b3na_:

Sequence; same for both SEQRES and ATOM records:

>d2b3na_ d.38.1.4 (A:) Hypothetical protein AF1124 {Archaeoglobus fulgidus [TaxId: 2234]}
evkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdln
pvhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrv
egvvsgveknrytidvkcytgdkvvaegvvkvliw

Timeline for d2b3na_:

• d2b3na_ first appeared in SCOPe 2.06
  
• d2b3na_ appears in SCOPe 2.07