Lineage for d2b32d_ (2b32 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936379Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2936380Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)
  7. 2936462Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
    Uniprot P07445
  8. 2936474Domain d2b32d_: 2b32 D: [303547]
    automated match to d1ogxa_
    complexed with iph

Details for d2b32d_

PDB Entry: 2b32 (more details), 1.25 Å

PDB Description: Crystal Structure of Ketosteroid Isomerase D40N from Pseudomonas putida (pKSI) with bound phenol.
PDB Compounds: (D:) steroid delta-isomerase

SCOPe Domain Sequences for d2b32d_:

Sequence, based on SEQRES records: (download)

>d2b32d_ d.17.4.3 (D:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d2b32d_ d.17.4.3 (D:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

SCOPe Domain Coordinates for d2b32d_:

Click to download the PDB-style file with coordinates for d2b32d_.
(The format of our PDB-style files is described here.)

Timeline for d2b32d_: