SCOPe 2.08: Domain d2b2ma1: 2b2m A:1-120

Lineage for d2b2ma1 (2b2m A:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.165: MOSC N-terminal domain-like [141672] (1 superfamily)
   complex fold; comprises a beta-hairpin and a meander 3-stranded sheet packed against beta-barrel: closed, n=5, S=8; contains three short helices

4. Superfamily b.165.1: MOSC N-terminal domain-like [141673] (1 family)

5. Family b.165.1.1: MOSC N-terminal domain-like [141674] (1 protein)
   Pfam PF03476

6. Protein Hypothetical protein BB0938 [141675] (1 species)

7. Species Bordetella bronchiseptica [TaxId:518] [141676] (2 PDB entries)
   Uniprot Q7WNU7 1-128

8. Domain d2b2ma1: 2b2m A:1-120 [303540]
   Other proteins in same PDB: d2b2ma2
   automated match to d2exna1

Details for d2b2ma1

PDB Entry: 2b2m

PDB Description: Solution structure for the protein coded by gene locus BB0938 of Bordetella bronchiseptica. Northeast Structural Genomics target BoR11.

PDB Compounds: (A:) Hypothetical protein BoR11

SCOPe Domain Sequences for d2b2ma1:

Sequence; same for both SEQRES and ATOM records:

>d2b2ma1 b.165.1.1 (A:1-120) Hypothetical protein BB0938 {Bordetella bronchiseptica [TaxId: 518]}
msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlk
apgmlrldipldviedddsvryqmlvgeqtvdvveegelaaawisnhagvpcrilkvhpd

Timeline for d2b2ma1:

• d2b2ma1 first appeared in SCOPe 2.06
  
• d2b2ma1 appears in SCOPe 2.07