Lineage for d2b2ma1 (2b2m A:1-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412940Fold b.165: MOSC N-terminal domain-like [141672] (1 superfamily)
    complex fold; comprises a beta-hairpin and a meander 3-stranded sheet packed against beta-barrel: closed, n=5, S=8; contains three short helices
  4. 2412941Superfamily b.165.1: MOSC N-terminal domain-like [141673] (1 family) (S)
  5. 2412942Family b.165.1.1: MOSC N-terminal domain-like [141674] (1 protein)
    Pfam PF03476
  6. 2412943Protein Hypothetical protein BB0938 [141675] (1 species)
  7. 2412944Species Bordetella bronchiseptica [TaxId:518] [141676] (2 PDB entries)
    Uniprot Q7WNU7 1-128
  8. 2412945Domain d2b2ma1: 2b2m A:1-120 [303540]
    Other proteins in same PDB: d2b2ma2
    automated match to d2exna1

Details for d2b2ma1

PDB Entry: 2b2m (more details)

PDB Description: Solution structure for the protein coded by gene locus BB0938 of Bordetella bronchiseptica. Northeast Structural Genomics target BoR11.
PDB Compounds: (A:) Hypothetical protein BoR11

SCOPe Domain Sequences for d2b2ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2ma1 b.165.1.1 (A:1-120) Hypothetical protein BB0938 {Bordetella bronchiseptica [TaxId: 518]}
msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlk
apgmlrldipldviedddsvryqmlvgeqtvdvveegelaaawisnhagvpcrilkvhpd

SCOPe Domain Coordinates for d2b2ma1:

Click to download the PDB-style file with coordinates for d2b2ma1.
(The format of our PDB-style files is described here.)

Timeline for d2b2ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b2ma2