![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.274: HAMP domain-like [158471] (1 superfamily) dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections |
![]() | Superfamily a.274.1: HAMP domain-like [158472] (1 family) ![]() automatically mapped to Pfam PF00672 |
![]() | Family a.274.1.1: HAMP domain [158473] (2 proteins) Pfam PF00672 |
![]() | Protein automated matches [191239] (1 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [189690] (6 PDB entries) |
![]() | Domain d2asxb2: 2asx B:278-331 [303529] Other proteins in same PDB: d2asxa3, d2asxb3 automated match to d2l7ha_ |
PDB Entry: 2asx (more details)
SCOPe Domain Sequences for d2asxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asxb2 a.274.1.1 (B:278-331) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} stitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame
Timeline for d2asxb2: