Lineage for d2aswb2 (2asw B:278-331)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738908Fold a.274: HAMP domain-like [158471] (1 superfamily)
    dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections
  4. 2738909Superfamily a.274.1: HAMP domain-like [158472] (1 family) (S)
    automatically mapped to Pfam PF00672
  5. 2738910Family a.274.1.1: HAMP domain [158473] (2 proteins)
    Pfam PF00672
  6. 2738917Protein automated matches [191239] (1 species)
    not a true protein
  7. 2738918Species Archaeoglobus fulgidus [TaxId:2234] [189690] (6 PDB entries)
  8. 2738944Domain d2aswb2: 2asw B:278-331 [303525]
    Other proteins in same PDB: d2aswa3, d2aswb3
    automated match to d2l7ha_

Details for d2aswb2

PDB Entry: 2asw (more details)

PDB Description: The solution structure of the hamp domain of the hypothetical transmembrane receptor Af1503
PDB Compounds: (B:) hypothetical protein AF1503

SCOPe Domain Sequences for d2aswb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aswb2 a.274.1.1 (B:278-331) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
stitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame

SCOPe Domain Coordinates for d2aswb2:

Click to download the PDB-style file with coordinates for d2aswb2.
(The format of our PDB-style files is described here.)

Timeline for d2aswb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aswb3