SCOPe 2.08: Domain d2aswb2: 2asw B:278-331

Lineage for d2aswb2 (2asw B:278-331)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.274: HAMP domain-like [158471] (1 superfamily)
   dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections

4. Superfamily a.274.1: HAMP domain-like [158472] (1 family)
   automatically mapped to Pfam PF00672

5. Family a.274.1.1: HAMP domain [158473] (2 proteins)
   Pfam PF00672

6. Protein automated matches [191239] (1 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [189690] (6 PDB entries)

8. Domain d2aswb2: 2asw B:278-331 [303525]
   Other proteins in same PDB: d2aswa3, d2aswb3
   automated match to d2l7ha_

Details for d2aswb2

PDB Entry: 2asw

PDB Description: The solution structure of the hamp domain of the hypothetical transmembrane receptor Af1503

PDB Compounds: (B:) hypothetical protein AF1503

SCOPe Domain Sequences for d2aswb2:

Sequence; same for both SEQRES and ATOM records:

>d2aswb2 a.274.1.1 (B:278-331) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
stitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame

Timeline for d2aswb2:

• d2aswb2 first appeared in SCOPe 2.06
  
• d2aswb2 appears in SCOPe 2.07