Lineage for d2aqma_ (2aqm A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2373678Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2373698Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2373736Species Brucella abortus [TaxId:235] [187418] (2 PDB entries)
  8. 2373737Domain d2aqma_: 2aqm A: [303522]
    automated match to d4l05a_
    complexed with cu1, gol, so4, zn

Details for d2aqma_

PDB Entry: 2aqm (more details), 1.1 Å

PDB Description: CU/ZN superoxide dismutase from brucella abortus
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2aqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqma_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Brucella abortus [TaxId: 235]}
esttvkmyealptgpgkevgtvviseapgglhfkvnmekltpgyhgfhvhenpscapgek
dgkivpalaagghydpgnthhhlgpegdghmgdlprlsanadgkvsetvvaphlkklaei
kqrslmvhvggdnysdkpeplggggarfacgvie

SCOPe Domain Coordinates for d2aqma_:

Click to download the PDB-style file with coordinates for d2aqma_.
(The format of our PDB-style files is described here.)

Timeline for d2aqma_: