Lineage for d1cj2a1 (1cj2 A:1-173,A:276-391)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1832683Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1832894Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 1832915Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries)
  8. 1832928Domain d1cj2a1: 1cj2 A:1-173,A:276-391 [30351]
    Other proteins in same PDB: d1cj2a2
    complexed with fad, phb; mutant

Details for d1cj2a1

PDB Entry: 1cj2 (more details), 2.8 Å

PDB Description: mutant gln34arg of para-hydroxybenzoate hydroxylase
PDB Compounds: (A:) protein (p-hydroxybenzoate hydroxylase)

SCOPe Domain Sequences for d1cj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cj2a1 c.3.1.2 (A:1-173,A:276-391) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas fluorescens [TaxId: 294]}
mktqvaiigagpsglllgqllhkagidnvilerrtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye

SCOPe Domain Coordinates for d1cj2a1:

Click to download the PDB-style file with coordinates for d1cj2a1.
(The format of our PDB-style files is described here.)

Timeline for d1cj2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cj2a2