SCOPe 2.08: Domain d2a7ra_: 2a7r A:

Lineage for d2a7ra_ (2a7r A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families)
   The phosphate moiety of substrate binds in the 'common' phosphate-binding site

5. Family c.1.5.0: automated matches [227276] (1 protein)
   not a true family

6. Protein automated matches [227084] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230557] (5 PDB entries)

8. Domain d2a7ra_: 2a7r A: [303500]
   automated match to d4zqma_
   complexed with 5gp, so4

Details for d2a7ra_

PDB Entry: 2a7r, 3 Å

PDB Description: Crystal structure of human Guanosine Monophosphate reductase 2 (GMPR2)

PDB Compounds: (A:) GMP reductase 2

SCOPe Domain Sequences for d2a7ra_:

Sequence; same for both SEQRES and ATOM records:

>d2a7ra_ c.1.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mphidndvkldfkdvllrpkrstlksrsevdltrsfsfrnskqtysgvpiiaanmdtvgt
femakvlckfslftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileai
pqvkyicldvangysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgi
gpgsvcttrkktgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvm
lggmlaghsesggelierdgkkyklfygmssemamkkyaggvaeyrasegktvevpfkgd
vehtirdilggirstctyvgaaklkelsrrttfirvtq

Timeline for d2a7ra_:

• d2a7ra_ first appeared in SCOPe 2.06
  
• d2a7ra_ appears in SCOPe 2.07