SCOPe 2.06: Domain d21gsb4: 21gs B:77-209

Lineage for d21gsb4 (21gs B:77-209)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries)

8. Domain d21gsb4: 21gs B:77-209 [303497]
   Other proteins in same PDB: d21gsb3
   automated match to d13gsa1
   complexed with cbl, mes

Details for d21gsb4

PDB Entry: 21gs, 1.9 Å

PDB Description: human glutathione s-transferase p1-1 in complex with chlorambucil

PDB Compounds: (B:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d21gsb4:

Sequence; same for both SEQRES and ATOM records:

>d21gsb4 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d21gsb4:

• d21gsb4 is new in SCOPe 2.06-stable
  
• d21gsb4 appears in SCOPe 2.07
  
• d21gsb4 appears in the current release, SCOPe 2.08