SCOPe 2.06: Domain d1pbfa1: 1pbf A:1-173,A:276-391

Lineage for d1pbfa1 (1pbf A:1-173,A:276-391)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)

7. Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries)

8. Domain d1pbfa1: 1pbf A:1-173,A:276-391 [30349]
   Other proteins in same PDB: d1pbfa2
   complexed with bha, fad; mutant

Details for d1pbfa1

PDB Entry: 1pbf, 2.7 Å

PDB Description: crystal structures of wild-type p-hydroxybenzoate hydroxylase complexed with 4-aminobenzoate, 2,4-dihydroxybenzoate and 2-hydroxy- 4-aminobenzoate and of the try222ala mutant, complexed with 2- hydroxy-4-aminobenzoate. evidence for a proton channel and a new binding mode of the flavin ring

PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1pbfa1:

Sequence; same for both SEQRES and ATOM records:

>d1pbfa1 c.3.1.2 (A:1-173,A:276-391) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas fluorescens [TaxId: 294]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye

Timeline for d1pbfa1:

• d1pbfa1 first appeared (with stable ids) in SCOP 1.55, called d1pbf_1
  
• d1pbfa1 appears in SCOPe 2.05
  
• d1pbfa1 appears in SCOPe 2.07
  
• d1pbfa1 appears in the current release, SCOPe 2.08