Lineage for d1zyaq2 (1zya Q:153-318)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203219Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)
  7. 2203309Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143536] (4 PDB entries)
    Uniprot Q8IKK7 153-318! Uniprot Q8T6B1 153-318
  8. 2203316Domain d1zyaq2: 1zya Q:153-318 [303489]
    Other proteins in same PDB: d1zyao1, d1zyao3, d1zyao4, d1zyap1, d1zyap3, d1zyap4, d1zyaq1, d1zyaq3, d1zyaq4, d1zyar1, d1zyar3, d1zyar4
    automated match to d2b4ro2
    complexed with gol, nad

Details for d1zyaq2

PDB Entry: 1zya (more details), 2.25 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 Resolution reveals intriguing extra electron density adjacent to the active site.
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1zyaq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyaq2 d.81.1.1 (Q:153-318) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdwragrcalsniipa
stgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegp
lkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswyd

SCOPe Domain Coordinates for d1zyaq2:

Click to download the PDB-style file with coordinates for d1zyaq2.
(The format of our PDB-style files is described here.)

Timeline for d1zyaq2: