SCOPe 2.07: Domain d1zyao1: 1zya O:4-152,O:319-335

Lineage for d1zyao1 (1zya O:4-152,O:319-335)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (4 PDB entries)
   Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337

8. Domain d1zyao1: 1zya O:4-152,O:319-335 [303480]
   Other proteins in same PDB: d1zyao2, d1zyao3, d1zyao4, d1zyap2, d1zyap3, d1zyap4, d1zyaq2, d1zyaq3, d1zyaq4, d1zyar2, d1zyar3, d1zyar4
   automated match to d2b4ro1
   complexed with gol, nad

Details for d1zyao1

PDB Entry: 1zya, 2.25 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 Resolution reveals intriguing extra electron density adjacent to the active site.

PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1zyao1:

Sequence; same for both SEQRES and ATOM records:

>d1zyao1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevtha
dgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsa
ppkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhit

Timeline for d1zyao1:

• d1zyao1 first appeared in SCOPe 2.06
  
• d1zyao1 appears in the current release, SCOPe 2.08