Lineage for d1zq0d_ (1zq0 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881110Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2881111Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2881136Family c.50.1.2: Macro domain [89724] (7 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 2881137Protein Histone macro-H2a1.1 [142547] (2 species)
  7. 2881138Species Human (Homo sapiens) [TaxId:9606] [142549] (6 PDB entries)
    Uniprot O75367 179-367! Uniprot O75367 181-371
  8. 2881150Domain d1zq0d_: 1zq0 D: [303473]
    automated match to d2fxka1

Details for d1zq0d_

PDB Entry: 1zq0 (more details), 2.54 Å

PDB Description: Crystal structure of the macro-domain of human core histone variant macroH2A1.1 (form A)
PDB Compounds: (D:) histone macroH2A1.1

SCOPe Domain Sequences for d1zq0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq0d_ c.50.1.2 (D:) Histone macro-H2a1.1 {Human (Homo sapiens) [TaxId: 9606]}
gftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefvea
vlelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclaladdk
klksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvq
emakldan

SCOPe Domain Coordinates for d1zq0d_:

Click to download the PDB-style file with coordinates for d1zq0d_.
(The format of our PDB-style files is described here.)

Timeline for d1zq0d_: