SCOP 1.75: Domain d1bf3a1: 1bf3 A:1-173,A:276-391

Lineage for d1bf3a1 (1bf3 A:1-173,A:276-391)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)

7. Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries)

8. Domain d1bf3a1: 1bf3 A:1-173,A:276-391 [30346]
   Other proteins in same PDB: d1bf3a2
   complexed with fad, phb; mutant

Details for d1bf3a1

PDB Entry: 1bf3, 2.2 Å

PDB Description: p-hydroxybenzoate hydroxylase (phbh) mutant with cys 116 replaced by ser (c116s) and arg 42 replaced by lys (r42k), in complex with fad and 4-hydroxybenzoic acid

PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOP Domain Sequences for d1bf3a1:

Sequence; same for both SEQRES and ATOM records:

>d1bf3a1 c.3.1.2 (A:1-173,A:276-391) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas fluorescens [TaxId: 294]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgkiragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye

Timeline for d1bf3a1:

• d1bf3a1 first appeared (with stable ids) in SCOP 1.55, called d1bf3_1
  
• d1bf3a1 appears in SCOP 1.73
  
• d1bf3a1 appears in SCOPe 2.01
  
• d1bf3a1 appears in the current release, SCOPe 2.08