Lineage for d1bf3_1 (1bf3 1-173,276-391)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20809Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)
  6. 20840Protein p-Hydroxybenzoate hydroxylase (PHBH) [51917] (2 species)
  7. 20856Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries)
  8. 20864Domain d1bf3_1: 1bf3 1-173,276-391 [30346]
    Other proteins in same PDB: d1bf3_2

Details for d1bf3_1

PDB Entry: 1bf3 (more details), 2.2 Å

PDB Description: p-hydroxybenzoate hydroxylase (phbh) mutant with cys 116 replaced by ser (c116s) and arg 42 replaced by lys (r42k), in complex with fad and 4-hydroxybenzoic acid
PDB Compounds: ( :)

SCOP Domain Sequences for d1bf3_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf3_1 c.3.1.2 (1-173,276-391) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgkiragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye

SCOP Domain Coordinates for d1bf3_1:

Click to download the PDB-style file with coordinates for d1bf3_1.
(The format of our PDB-style files is described here.)

Timeline for d1bf3_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bf3_2