Lineage for d1bf3_1 (1bf3 1-173,276-391)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins) 
Protein p-Hydroxybenzoate hydroxylase (PHBH) [51917] (2 species) Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries) 
Domain d1bf3_1: 1bf3 1-173,276-391 [30346]
Other proteins in same PDB: d1bf3_2
Details for d1bf3_1
PDB Entry: 1bf3 (more details), 2.2 Å
PDB Description: p-hydroxybenzoate hydroxylase (phbh) mutant with cys 116 replaced by ser (c116s) and arg 42 replaced by lys (r42k), in complex with fad and 4-hydroxybenzoic acid
SCOP Domain Sequences for d1bf3_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf3_1 c.3.1.2 (1-173,276-391) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgkiragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye
SCOP Domain Coordinates for d1bf3_1:
Click to download the PDB-style file with coordinates for d1bf3_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bf3_1:
- d1bf3_1 appears in SCOP 1.57
- d1bf3_1 appears in the current release, SCOPe 2.08, called d1bf3a1
View in 3D
