SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1bf3a1 (1bf3 A:1-173,A:276-391)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096721Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 2096742Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries)
  8. 2096754Domain d1bf3a1: 1bf3 A:1-173,A:276-391 [30346]
    Other proteins in same PDB: d1bf3a2
    complexed with fad, phb; mutant

Details for d1bf3a1

PDB Entry: 1bf3 (more details), 2.2 Å

PDB Description: p-hydroxybenzoate hydroxylase (phbh) mutant with cys 116 replaced by ser (c116s) and arg 42 replaced by lys (r42k), in complex with fad and 4-hydroxybenzoic acid
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1bf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf3a1 c.3.1.2 (A:1-173,A:276-391) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas fluorescens [TaxId: 294]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgkiragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye

SCOPe Domain Coordinates for d1bf3a1:

Click to download the PDB-style file with coordinates for d1bf3a1.
(The format of our PDB-style files is described here.)

Timeline for d1bf3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bf3a2