SCOPe 2.08: Domain d1zgmb2: 1zgm B:88-236

Lineage for d1zgmb2 (1zgm B:88-236)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Hypothetical protein AGR_pAT_752p/Atu5508 [140558] (1 species)
   putative glutathione S-transferase

7. Species Agrobacterium tumefaciens [TaxId:358] [140559] (2 PDB entries)
   Uniprot Q7D2W7 88-236

8. Domain d1zgmb2: 1zgm B:88-236 [303457]
   Other proteins in same PDB: d1zgma1, d1zgma3, d1zgmb1
   automated match to d2fnoa1
   complexed with scn

Details for d1zgmb2

PDB Entry: 1zgm, 1.9 Å

PDB Description: crystal structure of putative glutathione s-transferase (15162326) from agrobacterium tumefaciens at 2.25 a resolution

PDB Compounds: (B:) Putative glutathione S-transferase

SCOPe Domain Sequences for d1zgmb2:

Sequence; same for both SEQRES and ATOM records:

>d1zgmb2 a.45.1.1 (B:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}
lpatvegrtlsakivndandvldeltlnggremwtpekwqefvprlqkwirifadtgarn
glsaasgfmlgtekigvadivtailwttvadrfpaikgiiedtspiiwglsrrvvatapl
aalnsksfeeygnaycggeiekslrkvas

Timeline for d1zgmb2:

• d1zgmb2 first appeared in SCOPe 2.06
  
• d1zgmb2 appears in SCOPe 2.07