Lineage for d1zgmb2 (1zgm B:88-236)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713491Protein Hypothetical protein AGR_pAT_752p/Atu5508 [140558] (1 species)
    putative glutathione S-transferase
  7. 2713492Species Agrobacterium tumefaciens [TaxId:358] [140559] (2 PDB entries)
    Uniprot Q7D2W7 88-236
  8. 2713494Domain d1zgmb2: 1zgm B:88-236 [303457]
    Other proteins in same PDB: d1zgma1, d1zgma3, d1zgmb1
    automated match to d2fnoa1
    complexed with scn

Details for d1zgmb2

PDB Entry: 1zgm (more details), 1.9 Å

PDB Description: crystal structure of putative glutathione s-transferase (15162326) from agrobacterium tumefaciens at 2.25 a resolution
PDB Compounds: (B:) Putative glutathione S-transferase

SCOPe Domain Sequences for d1zgmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgmb2 a.45.1.1 (B:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}
lpatvegrtlsakivndandvldeltlnggremwtpekwqefvprlqkwirifadtgarn
glsaasgfmlgtekigvadivtailwttvadrfpaikgiiedtspiiwglsrrvvatapl
aalnsksfeeygnaycggeiekslrkvas

SCOPe Domain Coordinates for d1zgmb2:

Click to download the PDB-style file with coordinates for d1zgmb2.
(The format of our PDB-style files is described here.)

Timeline for d1zgmb2: