Lineage for d1zdzb_ (1zdz B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145654Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2145659Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 2145665Species Human (Homo sapiens) [TaxId:9606] [142590] (5 PDB entries)
    Uniprot P19623 15-300
  8. 2145675Domain d1zdzb_: 1zdz B: [303449]
    automated match to d2o06b_
    complexed with sam

Details for d1zdzb_

PDB Entry: 1zdz (more details), 2.12 Å

PDB Description: Human spermidine synthase
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d1zdzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdzb_ c.66.1.17 (B:) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}
airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk
talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn
pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd

SCOPe Domain Coordinates for d1zdzb_:

Click to download the PDB-style file with coordinates for d1zdzb_.
(The format of our PDB-style files is described here.)

Timeline for d1zdzb_: