Lineage for d1zb1b_ (1zb1 B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.8: TPR-like [48452] (11 families) 
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
Protein Bro1 [310760] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311015] (1 PDB entry) 
Domain d1zb1b_: 1zb1 B: [303441]
has additional insertions and/or extensions that are not grouped together
Details for d1zb1b_
PDB Entry: 1zb1 (more details), 1.95 Å
PDB Description: Structure basis for endosomal targeting by the Bro1 domain
PDB Compounds: (B:) BRO1 proteinSCOPe Domain Sequences for d1zb1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zb1b_ a.118.8.1 (B:) Bro1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkpylfdlklkdtekldwkkglssylkksygssqwrtfydekatseldhlrnnangelap
sslseqnlkyysflehlyfrlgskgsrlkmdftwydaeyssaqkglkytqhtlafeksct
lfniaviftqiareninedyknsianltkafscfeylsenflnspsvdlqsentrflani
chaeaqelfvlkllndqisskqytlisklsratcnlfqkchdfmkeidddvaiygepkwk
ttvtcklhfykslsayyhglhleeenrvgeaiafldfsmqqlisslpfktwlvefidfdg
fketlekkqkelikdndfiyhesvpavvqvdsikaldaiksptwekilepymqdvankyd
slyrgii
SCOPe Domain Coordinates for d1zb1b_:
Click to download the PDB-style file with coordinates for d1zb1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zb1b_:
- d1zb1b_ first appeared in SCOPe 2.06
- d1zb1b_ appears in SCOPe 2.07
View in 3D
