Lineage for d1zb1b_ (1zb1 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007338Protein Bro1 [310760] (1 species)
  7. 2007339Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311015] (1 PDB entry)
  8. 2007341Domain d1zb1b_: 1zb1 B: [303441]

Details for d1zb1b_

PDB Entry: 1zb1 (more details), 1.95 Å

PDB Description: Structure basis for endosomal targeting by the Bro1 domain
PDB Compounds: (B:) BRO1 protein

SCOPe Domain Sequences for d1zb1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zb1b_ a.118.8.1 (B:) Bro1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkpylfdlklkdtekldwkkglssylkksygssqwrtfydekatseldhlrnnangelap
sslseqnlkyysflehlyfrlgskgsrlkmdftwydaeyssaqkglkytqhtlafeksct
lfniaviftqiareninedyknsianltkafscfeylsenflnspsvdlqsentrflani
chaeaqelfvlkllndqisskqytlisklsratcnlfqkchdfmkeidddvaiygepkwk
ttvtcklhfykslsayyhglhleeenrvgeaiafldfsmqqlisslpfktwlvefidfdg
fketlekkqkelikdndfiyhesvpavvqvdsikaldaiksptwekilepymqdvankyd
slyrgii

SCOPe Domain Coordinates for d1zb1b_:

Click to download the PDB-style file with coordinates for d1zb1b_.
(The format of our PDB-style files is described here.)

Timeline for d1zb1b_:

  • d1zb1b_ is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d1zb1a_