Lineage for d1z4ba2 (1z4b A:65-322)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126370Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2126657Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 2126668Species Methanococcus voltae [TaxId:2188] [110555] (14 PDB entries)
    Uniprot O73948
  8. 2126677Domain d1z4ba2: 1z4b A:65-322 [303429]
    Other proteins in same PDB: d1z4ba1
    automated match to d1t4ga2
    complexed with adp, k, mg

Details for d1z4ba2

PDB Entry: 1z4b (more details), 2.1 Å

PDB Description: RadA recombinase in complex with ADP
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d1z4ba2:

Sequence, based on SEQRES records: (download)

>d1z4ba2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvaklydsp
hlpdaeaifritekgiqd

Sequence, based on observed residues (ATOM records): (download)

>d1z4ba2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd

SCOPe Domain Coordinates for d1z4ba2:

Click to download the PDB-style file with coordinates for d1z4ba2.
(The format of our PDB-style files is described here.)

Timeline for d1z4ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z4ba1