Lineage for d1yzoa_ (1yzo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766366Species Langat virus [TaxId:11085] [255004] (2 PDB entries)
  8. 2766367Domain d1yzoa_: 1yzo A: [303427]
    automated match to d1z3ra_

Details for d1yzoa_

PDB Entry: 1yzo (more details)

PDB Description: NMR solution structure of domain III of the E-protein of tick-borne Langat flavivirus (includes RDC restraints)
PDB Compounds: (A:) major envelope protein E

SCOPe Domain Sequences for d1yzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzoa_ b.1.18.0 (A:) automated matches {Langat virus [TaxId: 11085]}
kgltytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlit
pnptmenngggfiemqlppgdniiyvgdlnhqwfqk

SCOPe Domain Coordinates for d1yzoa_:

Click to download the PDB-style file with coordinates for d1yzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1yzoa_: