![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Langat virus [TaxId:11085] [255004] (2 PDB entries) |
![]() | Domain d1yzoa_: 1yzo A: [303427] automated match to d1z3ra_ |
PDB Entry: 1yzo (more details)
SCOPe Domain Sequences for d1yzoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yzoa_ b.1.18.0 (A:) automated matches {Langat virus [TaxId: 11085]} kgltytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlit pnptmenngggfiemqlppgdniiyvgdlnhqwfqk
Timeline for d1yzoa_: