Lineage for d1yz8p2 (1yz8 P:1-60)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692777Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)
  8. 2692801Domain d1yz8p2: 1yz8 P:1-60 [303424]
    Other proteins in same PDB: d1yz8p3, d1yz8p4
    automated match to d2l7fp_
    protein/DNA complex; mutant

Details for d1yz8p2

PDB Entry: 1yz8 (more details)

PDB Description: Solution structure of the k50 class homeodomain pitx2 bound to dna and implications for mutations that cause rieger syndrome
PDB Compounds: (P:) Pituitary homeobox 2

SCOPe Domain Sequences for d1yz8p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yz8p2 a.4.1.0 (P:1-60) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrrqrthftsqqlqqleatfqrnrypdmstreeiavwtnltearvrvwfknrrakwrkre

SCOPe Domain Coordinates for d1yz8p2:

Click to download the PDB-style file with coordinates for d1yz8p2.
(The format of our PDB-style files is described here.)

Timeline for d1yz8p2: