Lineage for d1yw3f_ (1yw3 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963303Protein Hypothetical protein Smu.260 [143610] (1 species)
  7. 2963304Species Streptococcus mutans [TaxId:1309] [143611] (2 PDB entries)
    Uniprot Q8DW21 2-200
  8. 2963310Domain d1yw3f_: 1yw3 F: [303422]
    Other proteins in same PDB: d1yw3a2, d1yw3b2, d1yw3c2, d1yw3d2, d1yw3e2
    automated match to d2ifaa1
    complexed with fmn

Details for d1yw3f_

PDB Entry: 1yw3 (more details), 2.3 Å

PDB Description: Crystal Structure of the Putative Nitroreductase in Complex with FMN from Streptococcus mutans, Northeast Structural Genomics Target SmR5.
PDB Compounds: (F:) Hypothetical protein SMU.260

SCOPe Domain Sequences for d1yw3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yw3f_ d.90.1.1 (F:) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgd

SCOPe Domain Coordinates for d1yw3f_:

Click to download the PDB-style file with coordinates for d1yw3f_.
(The format of our PDB-style files is described here.)

Timeline for d1yw3f_: