SCOPe 2.06: Domain d1yw3e1: 1yw3 E:2-200

Lineage for d1yw3e1 (1yw3 E:2-200)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)

6. Protein Hypothetical protein Smu.260 [143610] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [143611] (2 PDB entries)
   Uniprot Q8DW21 2-200

8. Domain d1yw3e1: 1yw3 E:2-200 [303420]
   Other proteins in same PDB: d1yw3a2, d1yw3b2, d1yw3c2, d1yw3d2, d1yw3e2
   automated match to d2ifaa1
   complexed with fmn

Details for d1yw3e1

PDB Entry: 1yw3, 2.3 Å

PDB Description: Crystal Structure of the Putative Nitroreductase in Complex with FMN from Streptococcus mutans, Northeast Structural Genomics Target SmR5.

PDB Compounds: (E:) Hypothetical protein SMU.260

SCOPe Domain Sequences for d1yw3e1:

Sequence; same for both SEQRES and ATOM records:

>d1yw3e1 d.90.1.1 (E:2-200) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgd

Timeline for d1yw3e1:

• d1yw3e1 is new in SCOPe 2.06-stable
  
• d1yw3e1 appears in SCOPe 2.07
  
• d1yw3e1 appears in the current release, SCOPe 2.08