SCOP 1.55: Domain d1pbd_1: 1pbd 1-173,276-391

Lineage for d1pbd_1 (1pbd 1-173,276-391)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)

6. Protein p-Hydroxybenzoate hydroxylase (PHBH) [51917] (2 species)

7. Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries)

8. Domain d1pbd_1: 1pbd 1-173,276-391 [30342]
   Other proteins in same PDB: d1pbd_2

Details for d1pbd_1

PDB Entry: 1pbd, 2.3 Å

PDB Description: crystal structures of wild-type p-hydroxybenzoate hydroxylase complexed with 4-aminobenzoate, 2,4-dihydroxybenzoate and 2-hydroxy- 4-aminobenzoate and of the try222ala mutant, complexed with 2- hydroxy-4-aminobenzoate. evidence for a proton channel and a new binding mode of the flavin ring

SCOP Domain Sequences for d1pbd_1:

Sequence; same for both SEQRES and ATOM records:

>d1pbd_1 c.3.1.2 (1-173,276-391) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye

Timeline for d1pbd_1:

• d1pbd_1 appears in SCOP 1.57
  
• d1pbd_1 appears in the current release, SCOPe 2.08, called d1pbda1