| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
| Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
| Protein Hypothetical protein Smu.260 [143610] (1 species) |
| Species Streptococcus mutans [TaxId:1309] [143611] (2 PDB entries) Uniprot Q8DW21 2-200 |
| Domain d1yw3c1: 1yw3 C:2-200 [303416] Other proteins in same PDB: d1yw3a2, d1yw3b2, d1yw3c2, d1yw3d2, d1yw3e2 automated match to d2ifaa1 complexed with fmn |
PDB Entry: 1yw3 (more details), 2.3 Å
SCOPe Domain Sequences for d1yw3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yw3c1 d.90.1.1 (C:2-200) Hypothetical protein Smu.260 {Streptococcus mutans [TaxId: 1309]}
snfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdf
wnkiayselekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqp
wseqahgialyaiwlalaeqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsiea
pagekefmadqerfkvfgd
Timeline for d1yw3c1: