Lineage for d1ypda1 (1ypd A:2-181)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108851Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2108852Protein automated matches [227126] (20 species)
    not a true protein
  7. 2108884Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255615] (4 PDB entries)
  8. 2108909Domain d1ypda1: 1ypd A:2-181 [303404]
    Other proteins in same PDB: d1ypda2, d1ypdb2
    automated match to d2vk1a1
    complexed with mg, tpp

Details for d1ypda1

PDB Entry: 1ypd (more details), 2.4 Å

PDB Description: thdp dependent pyruvate decarboyxlase from yeast (form b)
PDB Compounds: (A:) pyruvate decarboxylase (form b)

SCOPe Domain Sequences for d1ypda1:

Sequence, based on SEQRES records: (download)

>d1ypda1 c.36.1.0 (A:2-181) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgngd
ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

Sequence, based on observed residues (ATOM records): (download)

>d1ypda1 c.36.1.0 (A:2-181) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpshhtlgngdftvfhrmsan
isettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

SCOPe Domain Coordinates for d1ypda1:

Click to download the PDB-style file with coordinates for d1ypda1.
(The format of our PDB-style files is described here.)

Timeline for d1ypda1:

  • d1ypda1 is new in SCOPe 2.06-stable