SCOPe 2.08: Domain d1ymia_: 1ymi A:

Lineage for d1ymia_ (1ymi A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d1ymia_: 1ymi A: [303403]
   automated match to d3juha_
   complexed with anp; mutant

Details for d1ymia_

PDB Entry: 1ymi, 1.66 Å

PDB Description: Crystal structure of a mutant of human protein kinase CK2alpha with altered cosubstrate specificity

PDB Compounds: (A:) casein kinase II, alpha chain

SCOPe Domain Sequences for d1ymia_:

Sequence; same for both SEQRES and ATOM records:

>d1ymia_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvavkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvlidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmg

Timeline for d1ymia_:

• d1ymia_ first appeared in SCOPe 2.06
  
• d1ymia_ appears in SCOPe 2.07