SCOPe 2.08: Domain d1yh6b_: 1yh6 B:

Lineage for d1yh6b_ (1yh6 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (2 PDB entries)
   Uniprot P62256 4-155

8. Domain d1yh6b_: 1yh6 B: [303401]
   automated match to d2z5da1

Details for d1yh6b_

PDB Entry: 1yh6, 2.1 Å

PDB Description: Human ubiquitin-conjugating enzyme E2 H

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 H

SCOPe Domain Sequences for d1yh6b_:

Sequence; same for both SEQRES and ATOM records:

>d1yh6b_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pgkrrmdtdvvklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypfks
psigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidplngd
aaamylhrpeeykqkikeyiqkyateealk

Timeline for d1yh6b_:

• d1yh6b_ first appeared in SCOPe 2.06
  
• d1yh6b_ appears in SCOPe 2.07