Lineage for d1yh6a_ (1yh6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939033Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (2 PDB entries)
    Uniprot P62256 4-155
  8. 2939034Domain d1yh6a_: 1yh6 A: [303400]
    automated match to d2z5da1

Details for d1yh6a_

PDB Entry: 1yh6 (more details), 2.1 Å

PDB Description: Human ubiquitin-conjugating enzyme E2 H
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 H

SCOPe Domain Sequences for d1yh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yh6a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pspgkrrmdtdvvklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypf
kspsigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidpln
gdaaamylhrpeeykqkikeyiqkyateealk

SCOPe Domain Coordinates for d1yh6a_:

Click to download the PDB-style file with coordinates for d1yh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1yh6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yh6b_