Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (2 PDB entries) Uniprot P62256 4-155 |
Domain d1yh6a_: 1yh6 A: [303400] automated match to d2z5da1 |
PDB Entry: 1yh6 (more details), 2.1 Å
SCOPe Domain Sequences for d1yh6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yh6a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]} pspgkrrmdtdvvklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypf kspsigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidpln gdaaamylhrpeeykqkikeyiqkyateealk
Timeline for d1yh6a_: