Lineage for d1cc4a1 (1cc4 A:1-173,A:276-391)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins) 
Protein p-Hydroxybenzoate hydroxylase (PHBH) [51917] (2 species) Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries) 
Domain d1cc4a1: 1cc4 A:1-173,A:276-391 [30340]
Other proteins in same PDB: d1cc4a2
Details for d1cc4a1
PDB Entry: 1cc4 (more details), 2 Å
PDB Description: phe161 and arg166 variants of p-hydroxybenzoate hydroxylase. implications for nadph recognition and structural stability.
SCOP Domain Sequences for d1cc4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cc4a1 c.3.1.2 (A:1-173,A:276-391) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas fluorescens}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgahgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye
SCOP Domain Coordinates for d1cc4a1:
Click to download the PDB-style file with coordinates for d1cc4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cc4a1:
- d1cc4a1 appears in SCOP 1.57
- d1cc4a1 appears in the current release, SCOPe 2.08
View in 3D
